SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|34809|gw1.9.174.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|34809|gw1.9.174.1
Domain Number 1 Region: 227-269
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000152
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 2 Region: 160-191
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000628
Family CCCH zinc finger 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|34809|gw1.9.174.1
Sequence length 292
Sequence
VPFFKKKGRGRPATARKRSASPPASVLTVPVPSSSKTEVVLPSRKQAANLLSAGTKRTAA
QRDEDAHSDQEPEREGPDMKWTAAGSHVNAALEILQGDEAAAILAKRRRTEPTGDESVPD
DGLYHGQKGYASHIKKNQEVPKAMRVGPQRPNNSTIRTVTIVDYQPDVCKDYKETGYCGY
GDTCKFLHDRGTYLAGWQLDKLAENPRKQVEDVSDTDSDDDNDLPYSCYICRKPFTDPVV
TRCGHYFCSACAIKRFSKTPKCAVCFAPTAGIFNRADKVLEKMKKVQAEKGA
Download sequence
Identical sequences B8P1T7
XP_002469637.1.31404 104341.JGI34809 jgi|Pospl1|34809|gw1.9.174.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]