SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|41104|gw1.26.199.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|41104|gw1.26.199.1
Domain Number 1 Region: 75-100
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000144
Family CCCH zinc finger 0.0055
Further Details:      
 
Domain Number 2 Region: 107-131
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000785
Family CCCH zinc finger 0.0064
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|41104|gw1.26.199.1
Domain Number - Region: 155-183
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00353
Family CCCH zinc finger 0.0037
Further Details:      
 
Domain Number - Region: 132-154
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0455
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|41104|gw1.26.199.1
Sequence length 213
Sequence
DIIRPQFHQNNFQEELFVKNELGIKLDKDDQICRLSLTAAGCPLGLLHCPLRHTTPSTQN
FQPPKQLPTHPRERERLATVCKHWLRGLCKKGDACEFLHEYNLRRMPDCWWYAKYGYCSA
GDECLYAHPKERRIECPDYNRGFCKLGPDCPRKHIRRVACQLYLTGFCPLGPDCPRGHPK
PELPPAEAYEPPPQPSGRDLGPPPPGYGRYADF
Download sequence
Identical sequences B8P5C2
104341.JGI41104 XP_002470878.1.31404 jgi|Pospl1|41104|gw1.26.199.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]