SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|43300|e_gw1.8.251.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|43300|e_gw1.8.251.1
Domain Number 1 Region: 571-752,806-1098
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.83e-67
Family Tandem AAA-ATPase domain 0.025
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|43300|e_gw1.8.251.1
Domain Number - Region: 35-80
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000362
Family Double-stranded RNA-binding domain (dsRBD) 0.022
Further Details:      
 
Domain Number - Region: 217-268
Classification Level Classification E-value
Superfamily UBA-like 0.0213
Family UBA domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|43300|e_gw1.8.251.1
Sequence length 1337
Sequence
MPPRRGIVKSGNAGNSSKQSKPTGPAAPEEKPLFPPGSKYPLSLLHERCQKNGWEKPIVD
TVSRRQDNGFSFIVMLSRINKRTSQRESVRLEPHPLRVMPSALEARHWGATYALYRFCSG
IQLNLVLPPGPREYWNELSIEHKNAPEHQKWMYEADPFAARKAVEERQTRAAEKRDATAK
GTDAPSRNAQTSREFENAPEAKMASSLRELVEDSIKKAIALFPEAGDAEPSTIPSDAAAQ
LLQQLTSLGFKHAQARNAVAALSQPSALTQNLLRAQPPLQACIEFLILQIPECDLPPRFL
PSMNTYNPFVMSAHAGTDDLKKRWIEERAVKDCGWPARAVKECLTQEHLAESWPLLLAAL
NTKLVGDHWADVEQESVRTTGQIIDMDEDELEALGAYMSEQNELIIPLPIAPMKLVLSLL
TDGKTIKRDIPPPMYILSTTVPAYVRLHIVSQLICSFKEGTLVDPGESFVMAAVRLVEEE
WVRLEDHGTPDISIVLQHLTSSPVALHEESSPKAPQSFSNGRGRKRMTGVRRDDRTNARV
KEEFLALCQSQKYTEMLESRKKLPASASENKFLKLLDKHRCVVVVGETGCGKTTQLPQFV
LDSMILSGQGSEVSIIVTQPRRLSAIGVAARVSAERLDDGSVGYAIRGESKQDKRTKLLF
CTTGVVLRRLGAGDRLAHVTHVIVDEVHERSVDGDFLLLELKELLRTHPTLKVVLMSATI
NHEVFVKYFDSAPLLSIPGFTHPVEDRYLEDILPLIDYRPATSNRFVKGRVAEEESKRLQ
EELNSRGLDDDSVKAIQKISRSDRIDFDLISAVVEHIVSTAQKRGAILIFLTGVQEIRQC
MERLSDIPRAKIFPLHANLSSDEQRRVFSHTSEWKIIAATNVAETSITIDDVIYVIDAGK
VKETHYDPEVGLTRLDEQWVTRAAAKQRRGRAGRTQPGVCYKLYTIRQESKMAPFPVPEI
KRVPLESIALTVKVVHKDVKSFLSRALDPPEISAVDHALNVLEELSAIDQDGELTPLGRH
MAILPVDLRLGKMLILGTIFQCLGPMLTVAACLSSKPIFMSPMDKRDEATRARARFATAN
SDLLTDAHAYDECMRLRSEGKSQGALRAFCEENFISPTTVRDISSLRQDFLASLSELGFV
PNSSKPSDPELNVNSANENLLKAVILGGFWPRVARVHLPKSAIKFDRVQAGTIQRENTAK
EYKLYDLKEGRVFLHPGSILFGESAWKSPFVTYFAKHATTKVFLRDATEVPIYGMLLFGG
TVSVNHIGGGLTIGSKDAVIKLKAWPRIGVLICSLLSRLLDAQLKLCIEEGTILSVGQAN
PVMRAILALVEHDGLTQ
Download sequence
Identical sequences 104341.JGI43300 jgi|Pospl1|43300|e_gw1.8.251.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]