SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|45180|e_gw1.741.2.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|45180|e_gw1.741.2.1
Domain Number 1 Region: 5-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.78e-27
Family Ribosomal protein S14 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|45180|e_gw1.741.2.1
Sequence length 100
Sequence
MPNVRVLRDIKARNGVNANEILRRAYLYVARNQNLPPQVRYQAQLQLNTFGKYTRPTTVK
NRCAESGRGRGIMSEFGLCRYQFRLKALAGEIPGVKKASW
Download sequence
Identical sequences A0A1X6MSC3
104341.JGI45180 jgi|Pospl1|45180|e_gw1.741.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]