SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|45432|e_gw1.92.34.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|45432|e_gw1.92.34.1
Domain Number 1 Region: 261-316
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000839
Family RING finger domain, C3HC4 0.0011
Further Details:      
 
Domain Number 2 Region: 101-186
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000053
Family RING finger domain, C3HC4 0.051
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|45432|e_gw1.92.34.1
Domain Number - Region: 173-248
Classification Level Classification E-value
Superfamily RING/U-box 0.00324
Family Variant RING domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|45432|e_gw1.92.34.1
Sequence length 480
Sequence
MTKDKGKEKTPSIEYESLTSTRLQELVDEDIRNVASVLGLESPIGSILLRYFRWNKDLLL
ERFMDDPTTVLRNVGEPEHITSESSGEPNGRPNKRARFDTPSDFVCAICCDDQPESIFKL
RCAHAFCEPCWQIYITSKIKDEGQCLFNCMQDECKTIVDDPSVQKLVDTSAYDRYRELVT
QSYVSAHPEMRFCPHPSCNETVSCPSGKGSVLLTEVPTVRCGHGHVFCFGCGLDSNHRPL
ICKLTTVWLKSAREDAGTAQWIKANTRSCPKCENSIEKAGGCNRILCRHCNFQFCWLCRK
NWDIHGYNNEICNTWKEPEPDEIKTEAKQNLEKWLFYFDRFNNHELSARLDQELCERTEE
KMVNVQENSNLSWIEAKFVQNAVDELTACRLTLKWSYAMAYFLAAGNQKEMFEDIQADLE
KAVEALSQLLEESIEESTIKTLRQRMMDKTVYVQGRHEILLRDTAEGLAEGRWEWNVLLE
Download sequence
Identical sequences jgi|Pospl1|45432|e_gw1.92.34.1 104341.JGI45432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]