SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|45973|e_gw1.69.42.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|45973|e_gw1.69.42.1
Domain Number 1 Region: 326-381
Classification Level Classification E-value
Superfamily RING/U-box 5.2e-16
Family RING finger domain, C3HC4 0.0033
Further Details:      
 
Domain Number 2 Region: 125-155
Classification Level Classification E-value
Superfamily PA domain 0.00000127
Family PA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|45973|e_gw1.69.42.1
Sequence length 430
Sequence
MIHIFPLLAIFIFCAPVQSHPVDWLRKFSNAAREDGSWLWGWAWASDGTVSVVDRSPAIT
FPARPASFGAELPDPLLGYVIPLSSFTAPCLNLTASLSLWSRPDAVLGCPDLCAVGPYQP
DPTETWIALVQRGGCPFIEKARQAQRLGAKAVVVGGSGDSPDALLNMYSERDSSDVTIAA
TFIKYWDYVELLSMIANSNTTHAGLKTLSLLLSTEYSPWEWYSPIVTFVFILLLPSLLTF
ITLLIHRYRAARAAQRDRAPEDVVHNFPCRIWTGAGTGREKDGTDIPLMTNSFVSGPELE
QGLTESPEPALEHASTSCDRPLPAWADEQVECAICLELFAPGDRIRVLPCYHIFHADEID
EWLIHKKKLCPVCKMDVTRPHPPANHVQCQPNPNTPQPTPDSVPIPAHSPISDRTPLLQD
NSMHSYDTSS
Download sequence
Identical sequences A0A1X6MJJ2
jgi|Pospl1|45973|e_gw1.69.42.1 104341.JGI45973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]