SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|46118|e_gw1.99.52.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|46118|e_gw1.99.52.1
Domain Number 1 Region: 910-981
Classification Level Classification E-value
Superfamily RING/U-box 0.000000051
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 2 Region: 413-581
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000806
Family Clathrin heavy chain proximal leg segment 0.024
Further Details:      
 
Domain Number 3 Region: 32-156
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000659
Family WD40-repeat 0.023
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|46118|e_gw1.99.52.1
Domain Number - Region: 93-253
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0017
Family Soluble quinoprotein glucose dehydrogenase 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|46118|e_gw1.99.52.1
Sequence length 1022
Sequence
QWRQFTFFDLAPIRDIHDLGSPPEIFQKTPEISTLCSSSAGLIIADIHGSVYQLNREFEI
VRSWLAHAGGRVTHMVERKGILITLGEEDTARHPFLKVWDLEHTDNKTGLPALLRSTKVQ
SGSRPHPVSTIALSATLAYLAIGLGDGTVLLYRHLDQSIFSGSTSLSALPKPRVVHESAG
EPITGLGFREPGEDSPNTYLFIVTLNRVFAYHASGKGSGGQPTVVSELGCGLGCAAMDGN
SGDMVVARDEAIYVCGIDSRGSSFAYEGKKVAVHTHRNYMVIISPPIAPSVTAASATVRN
LAAKSKSADNAEITKLTVFDLENHFVAYTGTFTTGIREVFSVFGQIYALANDGSLSCLEE
KPTSAKLDMLYRKSLFLTALNVAKTQGLDPGEVADVQRRFGDHLYAKADYDGAVQQYLKT
IGHVQPSYIIRKFLDAQRIHNLVTYLQELHSLGRANSDHTTLLLNTYTKLKDVSRLDAFI
KRESARATDELPFDLDTAIRVCRQAGYFEHASYLAKKYERHEDYLRIQIEDAGNYKDALS
YLRRLGTEAAESNLARYGRAMLNNLPDETTQLLIDICTSLEPLTFDDDEPKGEHAALTRQ
PSTSGGPSYLSYLALNRSAGPGSSSATASDQGPVAPSSASTTTVKPGAPSLHNVKRPSPR
LFFAHFVDHLDCFVSFLETVALKRWGQIVDPIANGSVEVEPDSNALEEAERQDQVSVWNT
LLELYLAPGPTTAERQANQDKALRVLRSEGGRIPYDPTHALILCSTCGFTQGLVLLWERA
GMHEDILRFWMDEHRSSAESSEESAASEEVVRALRLYGPTHPSLYALVLRFLTSEPALLR
KHEEDVKDVLREVEERGVMQPMEVVRVLGRNNVVGVGIVRSWLARVITEGRQAVNVDQQL
IDSYRGETQAKLKQVQELSDPDRPRVFHVTQCAVCQGQLDLPSVHFMCGHSYHQRCLGEH
ETECPNCARAHGLIREIRQNNERLVDQHDVFLQEVREGGFSALAAGFGRGAMNLARLEDA
VV
Download sequence
Identical sequences jgi|Pospl1|46118|e_gw1.99.52.1 104341.JGI46118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]