SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|46557|e_gw1.199.33.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|46557|e_gw1.199.33.1
Domain Number 1 Region: 91-282
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000192
Family WD40-repeat 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|46557|e_gw1.199.33.1
Domain Number - Region: 734-888
Classification Level Classification E-value
Superfamily ARM repeat 0.000863
Family Clathrin heavy chain proximal leg segment 0.026
Further Details:      
 
Domain Number - Region: 906-938
Classification Level Classification E-value
Superfamily RING/U-box 0.06
Family RING finger domain, C3HC4 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|46557|e_gw1.199.33.1
Sequence length 968
Sequence
MSDKSVHHHARTNARTSRQSSATGSETDVDDHATDYGVNGHDRERIEREDEDEEGSGEEE
IDEDEDEDDDEEPALKYERLGGIAPKLFIKDSASAMACANQRLAIGTHSGMLHILELSGQ
LIKSFQVHSAAVMDISMDETAEWVATASIDGQVVVHSVSTPESQTFNMKRSLRTVALEPG
FAKSSTRAFVCGGMAGSLVLHEKGWLRYNETTLHSGEGPVWQTRWRNHLIAWANDLGVKI
YDTVSQSRITFIDRPPNSPRADLFKCTLHWQDDATLLIAWADQIKVARVRARPRPVTVAP
ASAGAPPFIVEITAVFQLDCMAAAASDATPAAPALTAFLLLAYTPPDVSLLAGEEAAVDR
AAQARKAAERPELRIVSRGGDELAADALGIADFERWGCNDYVLVEVDNAVSSAPSPASMG
AFGHRERYYIVSSPKDIVVVRPRDWRDHVEWLTERARYEEALAEIERQAAAGVTAGPGED
AVDAVRIGERYIESLISQGDFIKAASLCPKVCGQDTKRWEAWIFLFAKRSQLQAIIPYVP
TDSPTLGHLVYEVILAYYLAQDRQALLQTIRSWPKDIYDISTIILAIQAELDRAPSSSSM
QTTAPETVVLMECLAELYTMNRQPGKALPYFLRLRRPNVFELIRENNLFTAVQDQALLLV
EFDHELIERRRTLGVDVDPQQSAAITLLVDHIHSIPIGRVVQQLQSRTYYLYLYLDALFR
RDSQLTSDFADMQVKLYAEYAPTRLLDFLRASNHYSLEEAYNICSDGDMVPEMVFLLGRM
GNNKKALTLIIERLGDVNRAIDFAKEQHDDDLWEDLLKYSETRPAFIRGLLENVGAEIDP
IRLIRRIKNGLEIPGLKGALIKILHDFNLQASLLEGCQTILNGDAAELARQLHRNQTCGF
FLSAQTLCPMCNRPLYQHTHGHALLFLCRHAIHVSCVTSDEALAQQLDHSLVGMGIGGHH
GIGGKIAL
Download sequence
Identical sequences 104341.JGI46557 jgi|Pospl1|46557|e_gw1.199.33.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]