SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|50350|e_gw1.96.49.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|50350|e_gw1.96.49.1
Domain Number 1 Region: 668-841
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.00049
Further Details:      
 
Domain Number 2 Region: 93-156
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000836
Family LIM domain 0.018
Further Details:      
 
Domain Number 3 Region: 29-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000107
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|50350|e_gw1.96.49.1
Domain Number - Region: 3-28
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000317
Family LIM domain 0.023
Further Details:      
 
Domain Number - Region: 385-414
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0923
Family LIM domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|50350|e_gw1.96.49.1
Sequence length 841
Sequence
VRPCAACGKAMQGAFVRALGTVYHLQCFKCMDCGTVVASKFFPIDGPDGKQHPLCERDYF
RRLNLICAKCGMALRGSYITACNKKFHVEHFTCSVCPTLFGPQDSYYEHEGDVYCHYHYS
TRFATKCAGCNSAILKQFVEINRNMRDECWHPECYMINKFWNVKVVARRPALPSNSEEFE
GEPQEPPWTEEERRETAISLKEKQIRMEQQVYRIWTVLSAFEESSAACISDMLRQVSNGQ
YLEAIRMAEKFILHVEVLFATIDDLEWHFARLKLKGMSHVREARMLCRKTVDLFTLLSHT
QETGARRMGMTQELLALVTGLAHYLKILIRIALTGALKLEREHNVQEAITSFLDKLHMLA
IQGGNPSAKRMMKRANGEVNVVNPPSDLCAKCNQTVEEDCVRLGTYQRWHSHCLQCDTCG
KVAAVPAQKEADTTTFGPVPTKVYCVEHGHGGCKGGFMAVARLEQYAFLLNVALRRLYVV
LKKRGVVQLTPAAQQAASSRDLLENDPYRNSNDINRLKSVHLDRKLSATARVPRRSTVVE
SPTGKVAQPADAAHAQRPQELIPSHSFRPTMPAIEDGITLADIPQIVEAAQAREQHRSLP
RQSSIPFIAELSTLELAIVRHCAVVVLSHSPLQSQFDLDEILELVENKKNSFWKQLFKPG
NDKKNVKKKGVFGVPLELLVEREGADSLLGASRTAVKIPSFVDDVVSAMRQMDLSVEGIF
RRNGNIRRLKELTEAIDRDPSSVDLTQDNPVQLAALLKKFFRELPDPLLTYKLHRLFIAS
QSLPTEQERMRMLHMVSLILPKAHRETLEVLFVFLKWVASFAHLDTETGSKMDLQNLATV
I
Download sequence
Identical sequences jgi|Pospl1|50350|e_gw1.96.49.1 104341.JGI50350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]