SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|51260|e_gw1.5.95.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|51260|e_gw1.5.95.1
Domain Number 1 Region: 3-74
Classification Level Classification E-value
Superfamily VPS9 domain 2.09e-27
Family VPS9 domain 0.00026
Further Details:      
 
Domain Number 2 Region: 328-368
Classification Level Classification E-value
Superfamily UBA-like 0.00000000459
Family CUE domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|51260|e_gw1.5.95.1
Sequence length 369
Sequence
EEGADTFIPVLIYVVLKANPPHLLSNVEFINRFRNPTKLQSEAGYYLSSLMGAVSFIETM
DHTSLSQITQEEFEKNVEEVIQSLPSTESVTPESRTPPIVTSPRSSSTSLPSSHTGEESA
QPLALPTPAQALGEDARRFLQKTGDTISKPLNAIGRIFTEVLDNAEESLSSLPSPFAPGD
TFRGRQDSQQQIEHDRQLAQSLGYGVPQTPHGAAETHQQAGGYVTPYKPRVRRVPTPLSS
AQSSGSFQFNSPPSEDTPTRPRAGTGPYTNQPLAVGPSQSASAIRSRPGSLDLRPQSAHV
SRTPTPNLDLAGLQDEIDRAHERAAVAARETLRQIFPTTDPEIVEWVLEANEGDLGKSIE
ALLEMNGES
Download sequence
Identical sequences 104341.JGI51260 jgi|Pospl1|51260|e_gw1.5.95.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]