SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|51331|e_gw1.74.15.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|51331|e_gw1.74.15.1
Domain Number 1 Region: 143-471
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.94e-83
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000328
Further Details:      
 
Domain Number 2 Region: 5-68
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000165
Family Zf-UBP 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|51331|e_gw1.74.15.1
Sequence length 518
Sequence
MQLAAPTCGTCDSPLPRPFACLRCSYSGCWRDGHVKRHLEETGHTLCVDVKTGSIFCSEC
GDFVYDSGRPQLLRKRRTPVFEVQRLVSAHCTQFTRCTDGTRCREPFRSWSPNTKETAAL
ESSVPAACYGSSMISTLMNTSAGRRGLLNLGQTCFMNAILQSFAANPLLRHYFLSDKHNY
QLCKNEACICCEMDKVFTEVFSENTTPYGPTSFLATTWQASPDLSGYAQQDAHEFFMHAL
NEIHTKTRGSTKLHCICIVHSAFAGQLQSDVKCERCGNVTTATDPMFDISLELQDKSLGQ
AGQELTLASCLRKFTQPEKLGPNQYSCAKCGKASHATSKRLSIRKLPPVLSFQFKRFEHK
AGDKSAAHKIEAPVRFPSIINMAPFTSAVMDMKDREAKGSGTEFPGPRAMYEYDLFSVVC
HEGQINNGHYTCFARSRDEQWYRFDDDKVTHSSLGACLGSQSQAYMCFYVKRHLDYEPYV
TPSYKVTREAEAVKERERERKKEAARMREVEDDLLAMV
Download sequence
Identical sequences jgi|Pospl1|51331|e_gw1.74.15.1 104341.JGI51331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]