SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|52273|e_gw1.135.14.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|52273|e_gw1.135.14.1
Domain Number 1 Region: 306-376
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000125
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number 2 Region: 198-233
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000209
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|52273|e_gw1.135.14.1
Sequence length 556
Sequence
MTSSVFYKFKSQRDESRVTFDGTGISVFDLKKEVILANNMTKANDFDLVICDSSSGEEFK
DDSHVIPRSSSVLVKRVFVRPGKGKVAYYTGNTASPSGAPDSTSKNVGGVNSASSWHRGA
GNISKRFDVKSEREAPSQIFKVTPAPPTLTSSVTKDDEAAAMAAMFQAQTANWEETQEKM
SHAVRVHTNSRGGAGGRGRFHSHQPERPLPTSYVCYRCGQKGHWIQDCPTNNDREYDNRP
RIKRTTGIPRSFLKAVESPNGQIGQGVMVTPEGGYVVAQPDVASWQKQVTKHKGLTEADI
RERMPSDSSLVCPVDNKLFRDAVKTPCCGTLYCEECIQTHLLERDFICPNCGAKIASLDK
LIIDKPTRTKVGDYIDKEIERSHREGEEEASKSNGTPEPSGSNKVPFDQDYYSEQQPGEN
IDMSQIFAQSIPQIQAQISQIQIMLNNRSLPSQVRQQTQMKHQQLQMELQQAQMAAAMAA
TFQPGPAVGMPFNNMQGFQQPWSNPFPNQQPAGQDSAYQRLPLNNRRRNYLKRERPSDFL
EVGGSEHEAKMPRYWE
Download sequence
Identical sequences jgi|Pospl1|52273|e_gw1.135.14.1 104341.JGI52273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]