SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|53007|e_gw1.121.29.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|53007|e_gw1.121.29.1
Domain Number 1 Region: 212-307
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000109
Family Canonical RBD 0.012
Further Details:      
 
Domain Number 2 Region: 156-178
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000563
Family CCCH zinc finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|53007|e_gw1.121.29.1
Sequence length 322
Sequence
MPKLDINKAGWEQSEFPILCETCLGDNAFVRMSKQEYGRSCGTCARPFTVFRWNPGTGMR
YKTTVICQTCAKIKNVCQTCLLDLEYGLPTQVRDTALGVENEAPTSEINREYYAQNLEGK
LEGNKSLMDTTRASSAGKEMLKQLARTDPYYKRNRPHLCSFYAKGQCSRGSECPYRHELP
VDNELSKQNMQDRYHGRNDPVARKILSNHAATMGLQPPEDQSITSLFLTSLPANATEEAV
RTRVVKSLPALDPALIKSIVHVAKSRCAFVNFKDRQSAELAAQAWANGLDMDGETVNVKW
GRSKGSVAKSKPATAAATVIAA
Download sequence
Identical sequences 104341.JGI53007 jgi|Pospl1|53007|e_gw1.121.29.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]