SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|53207|e_gw1.98.29.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|53207|e_gw1.98.29.1
Domain Number 1 Region: 571-752,806-1098
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.53e-66
Family Tandem AAA-ATPase domain 0.022
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|53207|e_gw1.98.29.1
Domain Number - Region: 217-276
Classification Level Classification E-value
Superfamily UBA-like 0.0013
Family UBA domain 0.015
Further Details:      
 
Domain Number - Region: 35-80
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00131
Family Double-stranded RNA-binding domain (dsRBD) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|53207|e_gw1.98.29.1
Sequence length 1336
Sequence
MPPRRGIVKSGNAGNSSKQSKPAEPAAPEEKPLFPPGSKYPLSLLHERCQKNGWEKPIVD
AVSRRQDNGFSFVVMLSRINKRTSQRESVRLEPHPLRVMPSALEARHWGATYALYRFCSG
IQLNLVLPPGPREYWNELSIEHKNAPEHQKWMYEADPFAARKAVEERQTRAAEKRDASAK
GTDAPSRNAQTSREFENAPEAKMASSLRELVEDSIKKAIALFPEAGDAEPSTVPSDAAAQ
LLQQLTSLGFKQAQARNAVAALSQPSALAQNLLRAQPPLQACIEFLILQIPECDLPPRFL
PSMNTYNPFVMSAHAGTDDLKKRWMEERAVKDCGWPVRAVKECLTQGHLAESWPLLLAAL
NTKLVGDHWADVEQESVRTTGQIIDMDEDELEALGAYMSEQNELTIPLPIAPMKLVLPLP
TDRKTIKRDIPPPMYILSTTVPAYVRLHIVSQLICSFKEGTLVDPGESFVMAAVRLVEEE
WVRIEDHGTPDISIVLQHLTSSPVALHEESSPEAPQSSSNGHGRKRMTGVRRDDRTNARV
KEEFLALCQSQKYTEMLESRKKLPASASENKFLKLLDKHRCVVVVGETGCGKTTQLPQFV
LDSMILSGQGSEASIIVTQPRRLSAIGVAARVSAERLDDGSVGYAIRGESKQDKRTKLLF
CTTGVVLRRLGAGERLAHVTHVIVDEVHERSVDGDFLLLELKELLRTHPKLKVVLMSATI
NHEVFVKYFDSAPLLSIPGFTHPVEDRYLEDILPLIDYRPATSNRFVKGRDAEEESKRLQ
EELNSRGLDDDSVKAIQKISRSDRIDFDLISAVVEHIVSTAQKRGAILIFLTGVQEIRQC
MERLSNIPRAKIFPLHANLSSDEQRRVFSHTSEWKIIAATNVAETSITIDDVIYVIDAGK
VKETHYDPEVGLTRLDEQWVTRAAAKQRRGRAGRTQPGVCYKLYTRRQESKMAPFPVPEI
KRVPLESIALTVKVVHKDVKSFLSRALDPPEISAVDHALYVLEELSAINQDGELTPLGRH
MAILPVDLRLGKMLILGTIFQCLGPMLTVAACLSSKPIFMSPMDKRDEATRARARFATGN
SDLLTDAHAYDECMRLRSEGKSQGALRAFCEENFISPTTVRDITSLRQDFLASLSELGFV
PSSSKPSDPELNVNSANENLLKAVILGGFWPRVARVHLPKSAIKFDRVQAGTIQRENTAK
EYKLYDLKEGRVFLHPGSILFGESAWKSPFVTYFAKHATTKVFLRDATEVPIYGMLLFGG
AVSVNHIGGGLTVGSKDAVVKLKAWPRIGVLVNQLRHLLDAQLKLCIEEGTILGVGQANP
VMRAILALVEHDGLTQ
Download sequence
Identical sequences A0A1X6NEX7
jgi|Pospl1|53207|e_gw1.98.29.1 104341.JGI53207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]