SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|54826|e_gw1.159.3.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|54826|e_gw1.159.3.1
Domain Number 1 Region: 704-737
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000101
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|54826|e_gw1.159.3.1
Domain Number - Region: 422-492
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0497
Family beta-sandwich domain of Sec23/24 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|54826|e_gw1.159.3.1
Sequence length 738
Sequence
MLTNNRGEQLDTRFQYMKALDSLNQRVSDYSAWLNGTASNFTLPDHDNATAPLVNTFMTF
ESRLDPERGSYYTNLTGFWHGEVNLHNLTSPDMVNGTAASWLPLAESYTNATNMTALPQL
LGPWKWAATNKVALSVGDKALSAVQNVSQDIAIIHGKVELSEPHASEELKFDFDGVHFIS
NGSIYALSEPSGCHIDLRRVISLVPNAHLNETAYAILAEMTSRATKLKEKIDAGTIDQDA
FNDEDPPKVHCSFELYGQLVPTDVSQGSMQELEREIEKPTGIATVKAPELKLNGVLVSQN
CGILIEVNEVIGLKSPQLYRKITTYAGIATIVYLVMYKLLCREMARTSSTATLSRLSRYV
FFSQSLIDAIASVGHITLGILSDGRPSLAVLAPAGLSCLLFVAEARFSVGVGQSQISEDI
SPPAPQPIVTPAPTPALAPPTPSTPEQDAQRDQAPETTYPPAQQAPQVQTPQATVTSPTP
TTALPGQPSFLSVLWHHLRSDLSTRMWMTVSIFFLVVVRIIIRLSLPLFFIGSMYSFIWM
CQIYRSVRRGRSSPLSVEYMVGTTLCRLYFALYFLACPKNILDVEPRRWIYAVAVLMFAQ
ISMIVLQDRLGPTFFMGNRVIAVKTYDYHPSLPLPDTEDPQQTLGDCAICMDVIEVDPSL
RRRSKSSDGKERGDMLGLPSRSRRPGGIFGAVSAVGGGNARKNYSLAPCHHLFHTSCLEQ
WLAIKNICPQCRRPLPPL
Download sequence
Identical sequences 104341.JGI54826 jgi|Pospl1|54826|e_gw1.159.3.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]