SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|55916|e_gw1.132.5.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|55916|e_gw1.132.5.1
Domain Number 1 Region: 424-458
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000039
Family Erythroid transcription factor GATA-1 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|55916|e_gw1.132.5.1
Domain Number - Region: 11-71
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000349
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|55916|e_gw1.132.5.1
Sequence length 500
Sequence
PRPLFADWSLLTPDLHFLYLDPVLAHHLQDQAELLVNKSLLDFVHPDEQASAKLDLGSVL
ESRTLHGSVTRVRYSRLSRVRKVLGYQGPAQEWPDADKVAVDDNYMAIDIVINWASDGLV
LCFMHAVVDLSPHDNDEHHKTPWTNWCGTPFMSMDQVQLLHSRLLSAVPQPLSMSRVFQI
LLNQPERSLCMSWPPDQPEPGGPISKDFAKLAQDVQISSGSASGTDAKTSCSIIFACHKV
HPSTRELNPNEAATHSSHYYPPPGNHPYPDQAHSYSLPPVPAPSQYHNSFPPPPHHSAHY
SSGSNWPPHPESPGSPPHYQQWNTAPSVSSVRSSTYSAPPQQHQWPSQPPSYLDASSAPP
PPLNSGPQGSPYPPPNSGNDDPPPSPGSDTVPPSRVIHRRGSNTRDQYGNGGRSTGNPPV
GVARCASCKATHSPEWRKGPSGKKDLCNACGLRYARSRAKKEGGPPQQSRRRKDRVFDSL
SKEPSPSGSPVPAPYSNVRR
Download sequence
Identical sequences 104341.JGI55916 jgi|Pospl1|55916|e_gw1.132.5.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]