SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|55923|e_gw1.132.32.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|55923|e_gw1.132.32.1
Domain Number 1 Region: 74-99
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000144
Family CCCH zinc finger 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|55923|e_gw1.132.32.1
Sequence length 327
Sequence
TFGMKNKNKSARVQKQIATIEKQQAQAGKSRAALEKEKEKAMREKEKLDEEKRKREEAAL
FKPVQTQKVPFGVDPKTVLCAFYKAGHCDKGNKCKFSHDLNVGRKVEKKNLYEDSREEKL
ADTMDQWDEEKLRSVVLSKHGNPRTTTDIVCKFFIQAIESEKFGWFWECPNGESCQYRHA
LPPGFVLKSQKKAAEEAEKANTISLEEFLEVERHKLGSNLTPVTPETFAKWKQTRMNKKQ
AEDDALRKTKEQQAAAGKSNGMSGRDLFTFNPEWFEGEDEDEEDDWDLTRYRKEQEDADL
LAEEERIQSLSLGDQDGSPGVSNGDEE
Download sequence
Identical sequences 104341.JGI55923 jgi|Pospl1|55923|e_gw1.132.32.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]