SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|55926|e_gw1.132.34.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|55926|e_gw1.132.34.1
Domain Number 1 Region: 146-240
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000136
Family Canonical RBD 0.014
Further Details:      
 
Domain Number 2 Region: 84-114
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000361
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|55926|e_gw1.132.34.1
Sequence length 375
Sequence
MSSDADALETPVDIPKKQKKLRPARKQVKPGDVEKKEAPQTGKEYNIWYNKWAGGDREDS
YSNKVKSQTRCHIKKDAGMTRANMTGVKYCCLFFARGCCPYGWECEYLHQLPDASIALPD
TSKDCFARDKFADYRDDMGGVGSFQRQNRTLYIGRIKETGTGTETEEVVRRHFKEWGEVE
KIRVLQYRSVAFVTYVSEFNAQFAKEAMACQSLDNDEILNVRWATEDPNPVSKVQEKRRL
EDMGREAIQARMDPRIIDAVRAVQALEDGAIDEDEQGQEEEDGAPEAKRRRLEIEDTQQE
LSPEELEQVQEAEQELQQQEQFGQSNGLLSADALEGLKYFAEIRRRNGIAIVRSAPLQKP
PSEGLGLADYGSDED
Download sequence
Identical sequences 104341.JGI55926 jgi|Pospl1|55926|e_gw1.132.34.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]