SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|56042|e_gw1.2.39.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|56042|e_gw1.2.39.1
Domain Number 1 Region: 1-68
Classification Level Classification E-value
Superfamily RING/U-box 0.00000068
Family RING finger domain, C3HC4 0.04
Further Details:      
 
Domain Number 2 Region: 140-169
Classification Level Classification E-value
Superfamily RING/U-box 0.0000177
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|56042|e_gw1.2.39.1
Sequence length 169
Sequence
CVICTDPIYNDEVRAPCGDYYDRECIVALFEAAVRDESLFPPRCCRQHIPLTLVHRFLSA
ALVKLFHEKTKEFGTLKRIYCANSSCSRFLGAQVEGAFSRWLWPTYKCPAPRCGTSTCTN
CKSKVVGRRHRCSTDADRAVLALGETQGWARCPGCETMIELNHGCFHMT
Download sequence
Identical sequences 104341.JGI56042 jgi|Pospl1|56042|e_gw1.2.39.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]