SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|56042|e_gw1.2.39.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|56042|e_gw1.2.39.1
Domain Number 1 Region: 1-68
Classification Level Classification E-value
Superfamily RING/U-box 0.00000068
Family RING finger domain, C3HC4 0.04
Further Details:      
 
Domain Number 2 Region: 140-169
Classification Level Classification E-value
Superfamily RING/U-box 0.0000177
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|56042|e_gw1.2.39.1
Sequence length 169
Sequence
CVICTDPIYNDEVRAPCGDYYDRECIVALFEAAVRDESLFPPRCCRQHIPLTLVHRFLSA
ALVKLFHEKTKEFGTLKRIYCANSSCSRFLGAQVEGAFSRWLWPTYKCPAPRCGTSTCTN
CKSKVVGRRHRCSTDADRAVLALGETQGWARCPGCETMIELNHGCFHMT
Download sequence
Identical sequences jgi|Pospl1|56042|e_gw1.2.39.1 104341.JGI56042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]