SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|57540|e_gw1.63.7.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|57540|e_gw1.63.7.1
Domain Number 1 Region: 157-436
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-80
Family Protein kinases, catalytic subunit 0.00000995
Further Details:      
 
Domain Number 2 Region: 11-131
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.65e-22
Family FHA domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|57540|e_gw1.63.7.1
Sequence length 436
Sequence
MATDLPAGETQSTQQETQPASQTVNILEEHLWGCLLPCSPLCRRVDFQKIKRTYLIGRNE
EQRPGGNDIILPGKKISNYHCQIQWDGREERQAAVRVTDTSSNGTFINGIRIGKGRSMLV
YEGNEIAFGTAQQQDNPAEDYRFVYRHMAAGTPPTGLHAHYQMHQELGKGSFATVLKAMH
REDGEWFAIKVMQRNRLRSPVGNSTAGSPSFAREISILEELQHPNICQLKEVFYEDHTVS
SICGVDLVLEYIDGGDLLDYIVRRGYLTEPQAQYLTYQICDALAYIHSKNIAHRDLKPEN
VLLTSTNPPQVKVADFGLAKAVDSLTMLRTMCGTPCYLAPEVVLQESNNGYDQIVDSWSV
GVIVFSMLTGNNPFFDDDQEMHIKERVRTRAVDWNTLRQYAPQGATISSEKFVSRLLEND
PAIRMTASEARLHPWL
Download sequence
Identical sequences 104341.JGI57540 jgi|Pospl1|57540|e_gw1.63.7.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]