SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|57716|e_gw1.144.1.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|57716|e_gw1.144.1.1
Domain Number 1 Region: 304-403
Classification Level Classification E-value
Superfamily EF-hand 3.29e-26
Family Eps15 homology domain (EH domain) 0.00049
Further Details:      
 
Domain Number 2 Region: 115-215
Classification Level Classification E-value
Superfamily EF-hand 8.42e-20
Family Eps15 homology domain (EH domain) 0.0016
Further Details:      
 
Domain Number 3 Region: 4-96
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000721
Family Eps15 homology domain (EH domain) 0.0036
Further Details:      
 
Domain Number 4 Region: 1256-1305
Classification Level Classification E-value
Superfamily UBA-like 0.0000000255
Family UBA domain 0.013
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|57716|e_gw1.144.1.1
Domain Number - Region: 507-689
Classification Level Classification E-value
Superfamily Tropomyosin 0.0556
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|57716|e_gw1.144.1.1
Sequence length 1310
Sequence
MSKFTPSPAEVHLVNQIFAQADTQKLGVITGDAAVKIFSGSKLSPTVLADIWNLADEDNN
GVLTRKGVAVAVRLLGHAQRGEQITEALVNKPCPPPAIEGLTPPLIPQSTGIPSAKSPPP
GFPPLTAQDKGKFMKMFVGYGPTNGVLAGDKARDVFVKSKLPVDKLSQIWNLADTKNRGA
LDATDFTIAMYLIQACMSGQVHTLPATLPPGLYEQAGGKGPFDGVAVHTTGGSSTYSPSL
NSSFPRPVSMLEPQYTGQGSPLQPQMTGPMRSTPTAPSLPPRSALSNAATASAFPFLQQQ
TTGATQQPWDVTPAEKASADRLFEGLDTQKRGYIEGDIAVPFMLLSKLPEDVLAHVWDLA
DLNNDGRLTRDGFAVAMHLIQSRLNGKEVPASIPLTLIPPSMRGAAPGQAPPPQPSVQDS
IRDLIWDDSPPASATMPPPQQPALQPQATGTLSSRTPIASPPMRSQTISDPFASSTPVAT
RSPFAMPPRDDDEPAQTASPPLHDQSAEIGNVKNQLNSTNRSLEVAKAERDDMERKLSEQ
ASQLAALQTQLSSAKAAYETETRLLSALRERYNAQTMEMQQARENLIRGESDLSAVRVEK
AEIEGSFLRDKEDVRELQRKMTEVYMEVETLKAGVEKAKKEAKQQKGLLAIARKQLATRE
AERAKIQKELEEAHIELTDVTKELEEVQAKAAEEVPAPMTNGRGVASPDILARALAQPLP
ATPDIPTSPTGSVMSLGKSNNPFERVAMASSPGSRSQSPFLPFTNSAMLPTPPTAGGNAS
KEAEESTPVVAASPNPFRFSQAFSPEQVFSSLEAPAEAQLGVSPIDLMSPTDTDMFHTPP
SSATLTALSPMPQPLHEGADLEAPASTDTIVPTGPQASEHDELVEAPTNVNDQQQDTDLG
HQLKELEVEESDSDSDSESSDDEPLATIKAPTGPEPTIAEQPDAAGTSSIPEISAFDDSF
GITTEDTRPLSSFLPAAATPVRTAFGTPSAPTTAPVAPASSASVDTAQKTNGFVAETPGV
DDFDEAMGKISAVSSTNGGQSQPTQFDFGSAFDDNFDFAAATAVTTSVPATNDTNANMVP
AQATPNAFDSVFVGPETRPFSFDDAFGATSIQPHPSSSQPGSSNPSHGISFDDAFGGRNS
VLALDTSYTSTSSQSQQAPPPAQPRTSAAFPTTSPPLSPVRAASPPLDARRSSSPARRMS
PPPRHSSPKPRPSTASSDKEKAPSHRTSKLSIRLPFGRKKKAHDIPPVPPPLTSQHLVEE
PTPSADDDLPAVKQLCGMGFSRTQAVTALELHDYDLQRALNSLLGKDTVA
Download sequence
Identical sequences jgi|Pospl1|57716|e_gw1.144.1.1 104341.JGI57716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]