SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|57787|e_gw1.17.22.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|57787|e_gw1.17.22.1
Domain Number 1 Region: 184-263,511-673
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.04e-50
Family Tandem AAA-ATPase domain 0.00028
Further Details:      
 
Domain Number 2 Region: 2-31,74-175
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.93e-22
Family Tandem AAA-ATPase domain 0.0008
Further Details:      
 
Domain Number 3 Region: 306-377
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000505
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|57787|e_gw1.17.22.1
Sequence length 694
Sequence
IVFTGPNKPKKKEDLMQYDIVLTTYQTLALEWPDDEAEEREAKRKAKKKRTSDNFIESVS
EDEKSKKKKKKQELGLLFQVEWYRVVLDEAQNIRNKRTRSSRAVTKLESNYRWCLTGTPI
INGLSDAYGLLRFLRIRPWYDWNDFNSHISRFERKQPIVATSRLQAIFATMLLRRKKDSM
LDGKRLIELPLKEVILTKLTFTLEERDIYKMVELKSQAIFNRFLKAGTVLKNYHQVLVLL
LRLRQVCSHPCLIQEHNAAFIAAADLNDGNHDKRYELSRARQLVSDEFVESIQTKMKIII
LQRIEAEKESPDATIDDEECPICYDTFTDPVVTPCAHIFCRECISTCPITPKNQYADSSA
DNSDERPCPACRGVLVKHKLFSRSAFEPSDKDLGTADGAGGSTDGDASAVLADDCAEAEH
PKPGSTFRKRKLQKKCAYDSDEEEEEGDDDLNDFIVEDDEDEEEKDACLALRKRLGKRRA
IILSDDEMDIDDDVICGAKPDAEIPPEQVKLMPRFLPSTKMKHMMESLKAWAKSNPDEKT
LVISQWTQCLQLVSDYLTENGFLHVKYQGDMNRRKRDQAIRVFMAKDKATIMLMSLKCGG
VGLNLTRANRVISLDLGWSEAVESQAFDRVHRLGQTRPVYVHRLVIADTVEDRVLALQER
KKNLADGSLGEGNGKKLGRAFSMIIGYADCLMSS
Download sequence
Identical sequences jgi|Pospl1|57787|e_gw1.17.22.1 104341.JGI57787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]