SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|58362|e_gw1.156.7.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|58362|e_gw1.156.7.1
Domain Number 1 Region: 65-115
Classification Level Classification E-value
Superfamily RING/U-box 0.00000205
Family RING finger domain, C3HC4 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|58362|e_gw1.156.7.1
Sequence length 733
Sequence
MSTTTNTQTRATGQRGRRGKGRGGSRGSQRGKTTSSTAPETPQPDSLPASNSMQSAAKDD
PATEETDDDAVCWICAEPVKYYSLSECNHRTCHVCALRLRALYKKQECTFCKEPQPSVLF
TKSADTPWSLYTPDMIPYKDPKLSISFETQEMMEETLILLRFNCPDAECDYIGNGWSDLK
LHTRAVHGKLMCDLCIRFKKIFSHEHALYPPNVLPIHLPSMHRSHGRGAESKQQVEGGIH
PLCEFCRECFFSDDELYAHMREKHEECFVCKRHEVKDQYFRNYDALEQHFMHGHFPCIQP
QCLARKFVVFGSALDLKAHMVEEHGAEMSARDKKDAMRIQAEFEFEEVGGAGRRGRRDRQ
GREREREPPPLPVISALARGSGAGGRRREAFSGNLTLDNPSTSRTPNGNTLSRSQQPSRR
QSPSPPEAEAGTAERSPALVARINSLAPNPTSAVPAIQAAIRSYRASESGARDLISTVWN
ILDRNLDGSASIVNLLVDGMDEEEKRRDLLAAWNGFKVEQRGQFPELVPTSTGTQWAGVT
SGRVLNAKHSTASRSSAQSSRQLWDRVAQAAGSSSSTSSIPPARLPERFPPLQPPTTNPA
FRQSQRNTPWASSAAAATPVPMRGPTSVPGPGATSRSTPTLSKSAFPELPSLTVSRVPKS
AVSGNQSLKKILGESVPAVPAWAGKNGADPSTSSAAGESSAEGGNAQESTTGKGKKGKGK
QKQTLFTLGSFPT
Download sequence
Identical sequences jgi|Pospl1|58362|e_gw1.156.7.1 104341.JGI58362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]