SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|60980|e_gw1.12.23.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|60980|e_gw1.12.23.1
Domain Number 1 Region: 180-259,503-665
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.56e-51
Family Tandem AAA-ATPase domain 0.00027
Further Details:      
 
Domain Number 2 Region: 1-27,70-171
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-21
Family Tandem AAA-ATPase domain 0.00094
Further Details:      
 
Domain Number 3 Region: 304-370
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000429
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|60980|e_gw1.12.23.1
Sequence length 686
Sequence
GSNKPKNKRDLMQYDIVLTTYQTLALEWPDDEAEEREAKRKAKKKRTSDNFIESVSEDEK
SKKKKKQEPVGLLFQVEWYRVVLDEAQNIRNKRTRGSRAVTKLESNYRWCLTGTPIINGL
SDAYGLLRFLRIRPWYDWNDFNGHISRFERKQPVLATSRLQAIFATMLLRRKKDSMLDGK
RLIELPLKEVILTKLTFTLEERDIYKMVELKSQAIFNRFLKAGTVLKNYHQVLVLLLRLR
QVCSHPCLIQEHNAAFIAAADLNDGNHDKRYELSRARQLVSDEFVESIQTKMKNIALQRI
EAEKESPDATIDDEECPICYDTFTDPIVTPCAHIFCRECISTCPITPKESQARYKFDERP
CPACRGVLVKHKLFSRSAFEPSDKDLGTADGADGSIEGGASAVLVDDFAEVEHPKPGSTF
RKRKLQKKSAYDSDEEEEGDDDLSDFVVEDDEDEEEKDACLALRKRLGKRRAIILSDDEM
DIDDDVICGAKPDVEIPPEQVKLMPRFLPSTKMKHMMEFLKAWAESNPDEKTLVISQWTQ
CLQLVSDYLTENGFLHVKYQGDMNRRKRDQAIRVFMAKDKATIMLMSLKCGGVGLNLTRA
NRVISLDLGWSEAVESQAFDRVHRLGQTRPVYVHRLVIADTVEDRVLALQERKKNLADGS
LGEGNGKKLGRAFSMIICYDDCLMSS
Download sequence
Identical sequences jgi|Pospl1|60980|e_gw1.12.23.1 104341.JGI60980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]