SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|61015|e_gw1.136.1.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|61015|e_gw1.136.1.1
Domain Number 1 Region: 647-707
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000212
Family RING finger domain, C3HC4 0.0024
Further Details:      
 
Domain Number 2 Region: 504-542
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000924
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 34-117
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000685
Family Canonical RBD 0.0063
Further Details:      
 
Domain Number 4 Region: 144-275
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000321
Family Canonical RBD 0.035
Further Details:      
 
Domain Number 5 Region: 592-643
Classification Level Classification E-value
Superfamily RING/U-box 0.0000353
Family IBR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|61015|e_gw1.136.1.1
Sequence length 717
Sequence
PARKEPPVNMSLSVLDATRVTFGPGFDIQGLVTGFESRQVLLKGIPYGVTPAEITNALSH
LGEVVTVRLPDVHKTQGKHRDGLAVRVTFATYEEAAEAASSLDGSQLFDSPISARLLSFE
TASVGKGSLEDAAVFLEFPAASRRGYAGYETEELAAQALAKANGTELRGSWITAEYFQGL
PNIGAFNLRFHGLPPDAQAKDIDLYGANDGVMMDLPNYQSQKGAINRLRETLSELGELES
FNVLPPPYKRGVVRAWAHFTSTTTADIVCAALHNRKKRFCGFGKLYARHVRTLTYNLPRH
VFGALSSDLRFLSAYVWDNENGSSITVLDRRRGTGPSPPVKVKLGSTNMQALTRMKVAFE
KLLRGDIITQNGEILWDGFFARRGGILYLEDLEKRHPGIIIHRDPRRRRLALFGPAVKRG
IVRSTILARVASLRAQKTHVLPLQGRMIGLFMSADLARLQSELGAENVKLDLWARVLTVR
GDDEAYKVAQQAIKRARDRHTGERQHHEVECPVCFDEVTSPVSLACGHTWCKTCLANYLM
ASVDNKVFPLTCLGNEARCPHAIPLNVAQEVLSPNDFSSVIHAAFLAYVNSRPNEFHYCP
TPDCPQVYRKGSRNTVLQCPSCLTRICPHCHVEYHEGSRCQDKEDAEDERLFEEWKKNHD
VKECPSCRVPIEKLAGCNHMTCAHCRTHICWVCLETFTMSETVYDHMRSAHGGIGLG
Download sequence
Identical sequences jgi|Pospl1|61015|e_gw1.136.1.1 104341.JGI61015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]