SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|61556|e_gw1.229.1.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|61556|e_gw1.229.1.1
Domain Number 1 Region: 15-119
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.87e-21
Family FHA domain 0.0029
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|61556|e_gw1.229.1.1
Domain Number - Region: 217-345
Classification Level Classification E-value
Superfamily Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.00876
Family Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|61556|e_gw1.229.1.1
Sequence length 354
Sequence
MPTPFAAASHGPVPLPALYLYPLNDSFVPKHISLINGQRVKIGRQTNAKTVPAERNGYFD
SKVLSRQHAEVWEEAAKIFIKDVKSSNGTFINGERLSPEGVESEPFELKSDDIVEFGIDI
VGEDNKTIIHHKVAARVVCVFTEQEAQAAARAEAQAGPASYGVGAGGGAPPAAGAFSFAP
GQPPNAPGQQRRPSLQQGLIGLGDRGGNMRAPGKSGLTFDHILSRLQGELQKSRDTGAEL
HSLTSAMNEIHDTLGGNLPPNLPPHPSNLPPVMPPQSQQQQESEQQQAPAAPSSSESGLA
LSELQSQLRETQMSLASHVDKIRSLETMLAEHEAIKREVGSLRELMEERKREMD
Download sequence
Identical sequences jgi|Pospl1|61556|e_gw1.229.1.1 104341.JGI61556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]