SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|64042|e_gw1.104.4.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|64042|e_gw1.104.4.1
Domain Number 1 Region: 648-708
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000194
Family RING finger domain, C3HC4 0.0027
Further Details:      
 
Domain Number 2 Region: 505-542
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000299
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 35-117
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000148
Family Canonical RBD 0.0056
Further Details:      
 
Domain Number 4 Region: 593-644
Classification Level Classification E-value
Superfamily RING/U-box 0.0000353
Family IBR domain 0.021
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|64042|e_gw1.104.4.1
Domain Number - Region: 143-276
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000144
Family Canonical RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|64042|e_gw1.104.4.1
Sequence length 718
Sequence
PPPRKEPPANMSLSVLDATRVTFGPGFDIQGLVTGFESRQVLLKGIPHGVTPVEITNALS
HLGEVVTVRLPDVHKTQGKHRDGFAVRVTFATYEEAAEAASSLDGTQLFDSPVSARLLSF
ETASVGKGSLEDAAVLLEFPAARRTGYAGYETRELAAQALAKANGTELRGSWVTAEFFEG
LPNIGAYNLRFHGLPPDAKAKDIDLYGANDGVMMELPNYQSQKGAINRLRETLSEIAELE
SFNVLPPPYKRGVVRAWAHFTSTTSADIVCAALHNRKKRFCGFGKLYARHVRTLSYNLPR
HVYEALSSDLRFLSAYVWDHENGSSITVLDRRRGTGPSPPVKVKLGSTNMHALTRMKVAF
EKLLRGDIITQNGEFLWDGFFARRGGILYLEDLEKRYPGIIIHRDPRRRRLALFGPAAKR
DMVRSAILARVASLRAQKTHILPLQGRMIGLFMSADLARLQRELGAENVKLDLWERVLTV
RGDDEAYKVAQQAIKRARDRHTGERQHHEVECPVCFDEVTSPVSLACGHTWCKTCLANYL
MASVDNKVFPLTCLGNEARCTHAIPLNVAQEVLSPNDFSSVIHAAFLAYVNSRPNEFHYC
PTPDCPQVYRKGSRNTVLQCPSCLTRICPHCHVEYHEGSRCQDKEDAEDERLFEEWKKNH
DVKECPSCRAPIEKLAGCNHMTCAHCRTHICWVCLETFTMSETVYDHMRSAHGGIGLG
Download sequence
Identical sequences 104341.JGI64042 jgi|Pospl1|64042|e_gw1.104.4.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]