SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|88219|fgenesh3_pm.3__3 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|88219|fgenesh3_pm.3__3
Domain Number - Region: 35-70
Classification Level Classification E-value
Superfamily RING/U-box 0.0271
Family U-box 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|88219|fgenesh3_pm.3__3
Sequence length 312
Sequence
MGNDGGSIPDRRDLVRTKAKAEQADKANQTRARWFFCALSKRPLQEPIISCALGKLYNKD
SILEYLLDKSAYGDGEEICGHIRSLKDVKTLKLTHNTSKIVASDSTDLAAFVCPLNFKEM
NGSQPFMYIATCGCVFSLAGYNAVSGNTSPSAKEGKLEAEGKEHDNGQNTKQLDVCPQCA
TKYDRSADVMTLNPGPEEEATMYEAMMRKRAAEPAKTKGKKRKAHADAVDGETPPTKKRV
SPTPAMNPALAAASKAVATSLAREEIKRKANMSDAVRSLYASKDGPKKKETFMTMGTFTR
VRLILCFSRDHH
Download sequence
Identical sequences B8P004
XP_002469005.1.31404 jgi|Pospl1|88219|fgenesh3_pm.3__3 104341.JGI88219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]