SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|88727|fgenesh3_pm.51__12 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|88727|fgenesh3_pm.51__12
Domain Number 1 Region: 8-138
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.83e-28
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 167-255
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 4.34e-23
Family HCDH C-domain-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|88727|fgenesh3_pm.51__12
Sequence length 256
Sequence
MALAHGLRTIGVLGAGQMGLGITYVSALHARVPVLLYDRSTAQIQSGLKLMDKLLAKDVA
KGRITAEQASEARERVTVVDQEKAIQGMRDVDMVVEAVSENLSLKQSLFRTLSAELPPTT
ILASNTSSISITKIAAATIPEGHSAADEQGRKSAARVVEVTTSQDVPGFVSNALLMPFIN
EAIMCLEKGVATRDDIDKTLKLGMNHPMGPLQLAIQQTLYVGTGDSKYRPSILLERMVDA
GWYGKKSGKGFYEYPQ
Download sequence
Identical sequences A0A1X6MZA5 B8P932
XP_002472171.1.31404 jgi|Pospl1|88727|fgenesh3_pm.51__12 104341.JGI88727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]