SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|89156|fgenesh3_pm.218__3 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|89156|fgenesh3_pm.218__3
Domain Number 1 Region: 206-259
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000858
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 2 Region: 4-36
Classification Level Classification E-value
Superfamily RING/U-box 0.00000619
Family RING finger domain, C3HC4 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|89156|fgenesh3_pm.218__3
Sequence length 286
Sequence
MRRFDACALCLQRAREPVACQKGHLFCKECSRRCRTLSDRRLGWKHSSARRKRRNEAHER
LPASAASWASQQQRPQTNVRPPPRILRKFDFSESTVDTLAREAEEAALRQIEREQAEALK
HKLPDFWLPSLTPTYASSGPPASLADVKLQTTCRGGNPPHHLTRKTLIPVHFIFDTSAST
QPRSVESTPSTESGTEAKPKRDEEKTAICPSCKKVLSNSALMNLMKPCGHVVCKTCTDTL
VKPAKQCIQCDVQLADKDIIELAREGTGYAAGGLAETSKKGVAFQG
Download sequence
Identical sequences B8PLB7
jgi|Pospl1|89156|fgenesh3_pm.218__3 XP_002476470.1.31404 104341.JGI89156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]