SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|89695|fgenesh3_pm.1866__1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|89695|fgenesh3_pm.1866__1
Domain Number 1 Region: 146-240
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000111
Family Canonical RBD 0.014
Further Details:      
 
Domain Number 2 Region: 84-114
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000314
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|89695|fgenesh3_pm.1866__1
Sequence length 336
Sequence
MSSDADALETPVDIPKKQKKLRPARKQVKPGDVEKKEAPQTGKEYNIWYNKWAGGDREDS
YSNKVKSQTRCHIKKDAGMTRANMTGVKYCCLFFARGCCPYGWECEYLHQLPDASIALPD
TSKDCFARDKFADYRDDMGGVGSFQRQNRTLYIGRIKETGTGTETEEVVRRHFKEWGEVE
KIRVLQYRSVAFVTYVSEFNAQFAKEAMACQSLDNDEILNVRWATEDPNPVSKVQEKRRL
EDMGREAIQARMDPRIIDAVRAVRALEDGAIDEDEQGQEEEDGAPEAKRRRADALEGLKY
FAEIRRRNGIAIVRSAPLQKPPSEGLGLADYGSDED
Download sequence
Identical sequences B8PPV0
104341.JGI89695 XP_002477705.1.31404 jgi|Pospl1|89695|fgenesh3_pm.1866__1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]