SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|90243|fgenesh3_pm.4__42 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|90243|fgenesh3_pm.4__42
Domain Number - Region: 253-315
Classification Level Classification E-value
Superfamily RING/U-box 0.0006
Family U-box 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|90243|fgenesh3_pm.4__42
Sequence length 318
Sequence
MITRVENLKRKVRXLCVMRERLQHLAAVEDIPSVNEPEFTRWADTRLDRWLVDWALRTGK
EKTARMIAEDRGIERLVDIDLFSDVCRIEEGLKRQSCSEALAWCSENKSSLRKLKNTLEF
DLRLQEYIELARARKNEDAIAYSKKHLLPWQETHLAQIRQAAALLCFPPTTTCGPYKRLY
DPARWTTLVQSFRLAVYNLSTLPTEPLLHLAVYAGLASLKLPACYDRHTKNTNCPVCDPN
LGELAKEVPYSHHVNSTIVCRLSGKIMDADNMPMAFPNGYVYSKEALEEMALRDDGYVTC
PRTGDRCLFSELRKVFIS
Download sequence
Identical sequences B8P0D0
jgi|Pospl1|90243|fgenesh3_pm.4__42 XP_002469118.1.31404 104341.JGI90243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]