SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|90662|fgenesh3_pm.138__4 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|90662|fgenesh3_pm.138__4
Domain Number 1 Region: 78-196
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 0.00000000000000183
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0013
Further Details:      
 
Domain Number 2 Region: 27-76
Classification Level Classification E-value
Superfamily UBA-like 0.000000643
Family TS-N domain 0.032
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|90662|fgenesh3_pm.138__4
Domain Number - Region: 212-339
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 0.0159
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|90662|fgenesh3_pm.138__4
Sequence length 341
Sequence
MLAARFASRAFPRTRLYSTAPKRSLKELVTELRSQADVSPIQAGQALKASDMDVSKALLW
LEKQRTQSAVKKAAKVADRTANEGLIGTTVLSSGVANGRRVGVRAAMVELNCETDFVARN
ELFANLLEDITHTAAFISEPANAETFMQPFSMETLQNAPLLSQTKPSQNGKATVSEAMRD
LTGRVGEKISLRRALTVVRDPFTSSQPDLALRVAARVHQSVFNPTQGRIGSLALLALKSK
RLSEAIASQTFQDDLDKLCQALGRQVIGFPTTCIRSPPGTTDEGALYDQPFSMFIGPGND
QSVGAFLQSWAQERSLVNKDEEQSAGVEVLEFAKWTVGDVV
Download sequence
Identical sequences A0A1X6NER0 B8PHE1
104341.JGI90662 jgi|Pospl1|90662|fgenesh3_pm.138__4 XP_002475109.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]