SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|90716|fgenesh3_pm.66__10 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|90716|fgenesh3_pm.66__10
Domain Number 1 Region: 283-351,611-779
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.53e-60
Family Tandem AAA-ATPase domain 0.00021
Further Details:      
 
Domain Number 2 Region: 32-274
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.29e-49
Family Tandem AAA-ATPase domain 0.00022
Further Details:      
 
Domain Number 3 Region: 413-450,484-494
Classification Level Classification E-value
Superfamily RING/U-box 0.0000055
Family RING finger domain, C3HC4 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|90716|fgenesh3_pm.66__10
Sequence length 799
Sequence
MAEFITKAIDNSSHGVTVKSAMEKLGLQSKRDLLPGLEIRLLPHQLIGVSWMIDQERNGP
HKGGILADEMGLGKTVQMIGIMAMNLPDEREQHRTTLIVVPAALLLQWKEEIENKTNGLF
TVHIHHGRDKLRSIHAIQEKDVIITTYHTLNSDFAMPDDVESGGELQWLLDNGGLLARMR
WYRVILDESQFIRNRATRSSKAVAMLRAKYRWCLTGTPITNTLADIYGYLRFGRFRPWND
WDAFNEHIARIQMQDAPLAGLRAQEVLKPLLLRRTKDADLEGEPLLQLPEKHIDIVTLEF
SEDERELYDNFEKRARIQINRFLKDNNVVKKCVLILRMRQLCCHPNLILRQAEGFEDPTL
LVGSDADKEVARANTMLGPQWVMEVWEQLIRVLRSFMARAKASQLEFDDEMDEPEPTCPV
CGDLFMNDSGRLLACGHEICAECLQVLATSPIVHNGEFGNADERTNLRIEKEFETAAAKG
LRPCPTCKKMMNLRPDHVFRSLAFEPSQDEVRNALRRADNARRQIEELIELSSSSDEDLP
DVAELLSAVASSSPKGKGKVVKDEGEDDNNTDADLTMDEIRGKGKARRQGRDSSEQPHGM
SDHLIATWKRGDNNLEPSTKMLALVEHLQEWESTGDKTIVFSQWTSMLDLLETLFSRYGI
RSLRYDGKMSREARELVLSQFRKSGGPKVILISTKCGGVGLNLVSANRLINMDLGWNYAS
ESQAYDRVHRLGQEKEVFVKRLVVRNTIEERMLKLQETKVGLAEAALGEGTGVKLHKLSC
NAVMKTSTYADRDTALRDE
Download sequence
Identical sequences B8PB35
104341.JGI90716 XP_002472881.1.31404 jgi|Pospl1|90716|fgenesh3_pm.66__10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]