SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|91171|fgenesh3_pg.8__173 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|91171|fgenesh3_pg.8__173
Domain Number - Region: 349-380
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00507
Family LIM domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|91171|fgenesh3_pg.8__173
Sequence length 409
Sequence
MAQLLQPAAPDPGRISQILPAVKCSSCAQPVPIAELGDHICQPGSPVPSLAGKPLVSPLT
ALELDPAKHQSRVAFPVKTIQAQQPPASDLIPTTPTNIPHTAPQVVRRLSGGRPISGQVD
TKTGGEAGMAGVGMEPPKTPLSATPTTPSAASIRLPFFEKFKDSKLRSELQPEDNLDTTA
PDSDAESDYGGLAYARSSADEDEDEDKPLKTKLPPISTSVTPASDSDHKDKVRFPSIAGS
ESHYSESPVSPRLPQRSLSASTGTSTYSARTIAKSTGALDRVMETLLEDVVSPSTSAAAS
PAPLTAPLLPENQRDSRPPKLPTRSHTSPTLGTGRVEQARGKKRVKERVCAKCTKIIDDG
RWIQMEGGSVLCDKCWKSMYLPKVRAAVCLVPGCETDDVVVGDSAGDAA
Download sequence
Identical sequences B8P1R1
XP_002469577.1.31404 104341.JGI91171 jgi|Pospl1|91171|fgenesh3_pg.8__173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]