SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|91385|fgenesh3_pg.1__130 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|91385|fgenesh3_pg.1__130
Domain Number - Region: 1076-1125
Classification Level Classification E-value
Superfamily RING/U-box 0.053
Family ZZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|91385|fgenesh3_pg.1__130
Sequence length 1194
Sequence
MSGLLLRLKKSSENAMGEHSSASLHLQSGLGPEVAPGIGAFFSRKLSRDDTRSDYSTQSD
DIWTISETSDISRLSDHRPITIEATKAAHNMDINAPLRTPSPSLFSLDTLTDAMPRGTED
AWGAFTNIDTESSDPLPATEIEDYVVADAMSAALAVANNHPRQSSSQDIAAAGLRARPGV
VNTLLSSQTTNIDRRPAVFKPLEEITKIHPFVHVSVRAFKAFYALEMNRNSNERMVMNVL
SEVKNMLDVLVQYAASFQYVIHEADLHTSDSLKKVDPDALDGEGVTIEARMKILLEATAK
EIKECSNVCDAYSKAKTVVKVVKGPLWEGMFINYVKLFAKRRDEFKTVLSTYTAVQMIEI
DQKMDNLTRSVAEKTDVIINLLQNFIPAEQQAMRDKVERKGGASAVLHDEAVLHELISTE
AQSGPAGNDSKQAAGEIRDDMDEVEQQLDEPAVSTERNLQSFERKFEMEMEIHRGSDRVI
ESVRSGPHDKIVDKGWRGNAKARNLVLAIRDFYHERAEDKHRADGPHESPQDSWALPWIA
VKRLQPIVEAFDDDASGYVTIAKVNNFTKSRPADWSLLRWLAFWAVGWQSSVTAYRDKIH
EQFSVMFALKASVNTTNRRIVERYLDQVWQPIMLLTSSFQPCTTEDEIHNRFNDHIEAEE
TRLKRNLEAARYHIDDLTTLSLVTGPGRIEQYLFQLIYLIIKRDLDVMQLCRTRVISERE
LEDSIRSLWLVMAAVDDRHKELEETFRHQNLDPGQQFKITYCKLDTDEWEVSLDRAAYDI
DDAPHVDCTEASESLKPALGTWRCHMYTTDDRLIAPMFLLSIRVSPTDLGKFAASGVIPG
SSMFANFKLEGAYELQEGGRPGYSFVMECSAPFESKRFNGCVSEDGMTFSGTWGPSWKVV
GHFVFSRLPPEIMRYRPSPIDLQRNRTKALWRFALTATMGEVVRKKWSWDFFRQRRDFRR
RYLDLLFRTSSGRPLDADEEQELLDIERVLTPSDARFYQSLCDMRHQTACHHGKPFSAIN
LCEDQRYFGKIERQALAALQRATASFAEVEEQKHELITHRLAGDRGQTRNINSGEQVCTA
CKGALIRPCWYCIECENNVFICYSCDTKAISFVGKHSLTHILVDCSQKTDPGRSKSNMTH
GGASRSDAQGVEVENDRLFRLESRLSTMDERLIQVDLRLRDLRRLLETVISRLN
Download sequence
Identical sequences B8NZC6
jgi|Pospl1|91385|fgenesh3_pg.1__130 104341.JGI91385 XP_002468825.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]