SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|91391|fgenesh3_pg.1__136 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|91391|fgenesh3_pg.1__136
Domain Number 1 Region: 1012-1089
Classification Level Classification E-value
Superfamily RING/U-box 0.0000161
Family ZZ domain 0.0098
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|91391|fgenesh3_pg.1__136
Domain Number - Region: 1167-1231
Classification Level Classification E-value
Superfamily Tropomyosin 0.0621
Family Tropomyosin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|91391|fgenesh3_pg.1__136
Sequence length 1237
Sequence
MPSFFHPHRKPAGNGNATRKHSGHSLRLSAIFHSRHSTGDSEVICDSPASAGTNIVFCEV
QSSAPLPIFQSSPQNDRAFSNTDTESTDPVPATEAEDCVVAEAMSAVTVVMNNHPRLNTG
SQSLTLDFAAAALKAGQDVRSTLSSSQNTNTSHNEVVQKVHDFFDHIPVFVKVLEEVAKI
HPFIHVGVLTFKAFYILEMKRRSNEEKVVAVLVEVKDMLDVLVHLKKVDPGALDGEGVTI
EARMKILLEATAKEIKQCANVCDAYSKTKTVVKVVKGPLWEGTFINYVKLFAKRRDEFKF
MLSTYIAVKVNEIDQKMDNLTRSVAEKTDVIINLLQNFIPAEQQAMRDKVERKGGASAVL
HDEAVLHELITTEAQSGPAGNNPKQAAGRIRDSIEEVKRQLDDPAVVIERNLQSFERKFE
MQQRQIMEEMEKVIHRESDRVIESVRSGPHDKIVDKGWRGNAKARNLVLAIRDFYHERAE
DKHRADGPHESPQDPWALPWIAVKRLQPIVEAFDDDASGYVTIAKVNNFTKSRPADWSLL
RWLAFWAVGWQSSVTAYRDKIHEQFSAMFALKTSVHTANRRIVERYLDQVWQPIILLTSS
FQSYTTTGKMHSRFKDYIEAEETRVKRNLEAARYHIDDLTTLSLVTGPGRIEQYLFQLIY
LIIKRDLDVMQLCRTRVISERELEDSIRSLWLVMAAVDDRHKELEETFRHQNLDPGQQFK
ITYCKLFDHYHNPSSLFSRKGLGDIGHSKSHHHNITDVPGIDADAVLNHSHQDTDDWEVS
LDRAAYDMDDVPHVDCTEASESLKPALGTWRCHMYTTDDRLIAPMFLLSIRVSPTDLGKF
AASGVIPGSSMFANFKLEGAYELQEGGRPGYSFVMECSAPFESKRFNGCVSEDGMTFSGT
WGPSWKVVGHFVFSRLPPEIMRYRPSPIDLQRNRTKALWRFALTATMGEVVRKKWSWDFF
RQRRDFRRRYLGLLFRTSSGRPLDADEEQELLDIKRVLTPSDARFYQSLCDMRHQTACHH
GVTCDSCGGVISGARVVCLDCDTHEKSFSTIDLCDDQRCMAAQVGLDRRSDLPTPHLPSH
NVLKTRTMIHLRDFGKVERQALAALQRATASFAEVEEQKHELITHRLAGDRGQTRNINSG
EQVCTACKGALIRPCWYCIECEKQATDKEESLEHRLDFWESKLIVMDSRIDEQGSEMNSR
LVQLEMRLSKVDNRLAQVDERLVHMERLLEAVASRLD
Download sequence
Identical sequences B8NZC9
104341.JGI91391 jgi|Pospl1|91391|fgenesh3_pg.1__136 XP_002468748.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]