SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|91661|fgenesh3_pg.20__105 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|91661|fgenesh3_pg.20__105
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily NTF2-like 1.97e-20
Family NTF2-like 0.0015
Further Details:      
 
Domain Number 2 Region: 137-191
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000663
Family TAP-C domain-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|91661|fgenesh3_pg.20__105
Sequence length 192
Sequence
MTKTLHVGSEAAVKAMADLPITKHDITGSPEKFCVDAWPVQAGDSPQLFVTIHGQFTEEP
SLGIRSFDRSFILAPAPEGSRQTGWDVVILSDQLTVRAYSNHEAWTPGPMRVQAGEPMAS
GSSLQPPANPQIQVALSAMPEPQRSLVMEVLTRTGLNLEYAVQCLESNAWDVGRAIANFE
QVKGTLPRDAFL
Download sequence
Identical sequences B8P4D5
104341.JGI91661 jgi|Pospl1|91661|fgenesh3_pg.20__105 XP_002470515.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]