SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|91787|fgenesh3_pg.542__1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|91787|fgenesh3_pg.542__1
Domain Number 1 Region: 87-113
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000706
Family CCCH zinc finger 0.0053
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|91787|fgenesh3_pg.542__1
Domain Number - Region: 158-178
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0173
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|91787|fgenesh3_pg.542__1
Sequence length 271
Sequence
MAMSGLPPGTAPIKSEFLVSFAPRDLPDDDAAEGSTTHANGRRDDADPDPEGGKRLSGAQ
RKALAKEERKNKRGANKGRRFQKVRDEVELCWKVATGKACEFGAECRFTHDTSAYLAAKP
RDVHFPTSEDLTNSPPFVRPLVDEEMINEKHPSVDFSTRCPIFERTGECKHGLKCRFLGG
HVREGEGAILELNINEDKKADTAIAETEVNFIDANTLKLIRTKKYPQPISEAYLKVLLES
TGDDEKGSKGSQPADGEIQPAQKIMQTATTQ
Download sequence
Identical sequences B8PNZ7
XP_002477402.1.31404 104341.JGI91787 jgi|Pospl1|91787|fgenesh3_pg.542__1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]