SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|91916|fgenesh3_pg.26__88 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|91916|fgenesh3_pg.26__88
Domain Number - Region: 6-36
Classification Level Classification E-value
Superfamily RING/U-box 0.000353
Family RING finger domain, C3HC4 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|91916|fgenesh3_pg.26__88
Sequence length 206
Sequence
MADSPQEGNQCRICFDGEDPELGRLIRPCLCKGSISCGYKYHFARTRVVGIATNPDDERE
TTTYLYGVYSPVDVIQGLVRATVNTFVDDKLLDDTILSKGPPSSHIRAPGKPPGLLKRLV
RRFLLGLPVVGAGSIAHMLLSIPLPFHWVRLRTINRGRDSRDIMALIIVTVVLIGAARAL
YKVYRLTERLTQRLLLRAEDAILEVA
Download sequence
Identical sequences B8P5B5
104341.JGI91916 XP_002470874.1.31404 jgi|Pospl1|91916|fgenesh3_pg.26__88

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]