SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|92942|fgenesh3_pg.99__38 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|92942|fgenesh3_pg.99__38
Domain Number 1 Region: 81-141
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000583
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|92942|fgenesh3_pg.99__38
Sequence length 226
Sequence
MRVFNRCPNTILQVLQVPYESSYWYQKALITSELEDIFANAPRSPTDIANAHVLDAYARA
TGKAPSGTAEQQGSKKRVPCPEDDCPICYENMHGATEATLTFCDTCGNGLHTECFQQWAA
TARQKGQQVSCVFCRAKWVTSGPAAAAGASRSSEGYINLGSVAGLSHRVISARCIHDLKE
ASCHKILVVFPLCCDVFLLRRCPVGAVAFARDVSQVIEGVGSLKIL
Download sequence
Identical sequences B8PEA5
XP_002474016.1.31404 104341.JGI92942 jgi|Pospl1|92942|fgenesh3_pg.99__38

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]