SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|93747|fgenesh3_pg.141__26 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|93747|fgenesh3_pg.141__26
Domain Number 1 Region: 16-144
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000000000143
Family FHA domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|93747|fgenesh3_pg.141__26
Sequence length 189
Sequence
MDSDDDAPLVAFYEPKQTETPPPSPPKPSTIRRAPSPLSGVPYWGYLEPVDPKCRYKDWY
FFTEQPVYTLGAGEDVDLRVIGTSISAEHHCTIVWDGTDTPYAVHVVDYADQTWGAWGGT
FINDVRLLPGILSLLRHGDRITFLGEEPMATNENLRSSYLETGFTWVQCTRQGWRNTPTG
LLKSMKQQT
Download sequence
Identical sequences B8PHK8
104341.JGI93747 XP_002475174.1.31404 jgi|Pospl1|93747|fgenesh3_pg.141__26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]