SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|94002|fgenesh3_pg.76__46 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|94002|fgenesh3_pg.76__46
Domain Number 1 Region: 14-117
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.65e-16
Family FHA domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|94002|fgenesh3_pg.76__46
Sequence length 1194
Sequence
MDASDIGRYGTLSLLKRHDPDTIVASYPIDDSQITIGRDPSCSIRLYYPAVSALHCKLVF
NEDNKAFLVVLGSNGVLVDGCPVFPAPTNSAPATVPLPNNSTLEVHKKSFRFAYPPKHLR
PVFATLPPTPGPTDTPGRHRALRMSMIHSAHVFSPRPSDDPRENLRVLQSPMKSPFKMQQ
QRSDADTAGEDEIVLVESDHPRVVESDRDLVILDHVTVTDSAPPPSPYAQTSPTKSLAPQ
MLLPQQAWAPPRTPVRRPPRASLHRAVLIRSAQRVALRQEMQMEEEMEVEEVEESIMGDE
GMEDVEEEDDAGYEEQVVEVRDQEQRSTPMSGWRKSLEAVKGSLGWAFRAASVEAEPQAN
EDANSELTNDQDQYKEQEGHEEEEQGEHDYDEQGGHDYEEQLEQDDQQQYEEYGAYEQHD
EQTDDMPMNEQEDTLQPVSPPPRPLGAFMTPQPGASKRAMRSQRFRYSVGGIAPGGLSSS
VSGPTGPRRVRLVEPWKVTELLVPLKDTDVKEEDESKVEENVSVPPSTSPRKERATEEER
RAIRERRRSALTTPDNFFNGQVPGSRRTPFLQSTPALPSLFASASARNILGPSPAKANDS
STKVEESEENTEVLLARMRQMVEGVKKRQSMEASVEHSRRMSVSPRKKSTFSLLAAEAEQ
GIIAEEEEDRGMETDAVGGQPHDVDNEMGEEFDMFMGEEMAEEPVHADEAMDDEDENVPV
AGPSTHFQPPKTPKMNDLRHVFSAPAAPATPRFTGVRELFREVPTARETPRMDGVRDMFL
RERSKRGMEESALEGMGEMLASPAGWRGQPAPETAIDEREAEVAQQKHVSKPAPSRVTKS
KIVRPIASIPRRTPRSAAQLPESREPEPAIAPEASADVATAASKGARVAPRTRTRTAESA
QESAGASGSSRPRTEEEDTVPELASKTKPATRRKAASAASDDEAAAAPTTATRRTRKATA
SPAPEAEPSATRVVRRTRRTPVPEEPPAAPVAKPSTGRRGARAQPMEDVEVADQDPADQP
AAAARVRRNTRSKIPVGAVKEEDDGHAVPPAGETGVSRTARGRKALGSTGAKAAARAGTS
ASKSTTRARTAASAKKAAGESSGKSTPSEEGELEEETNAGDKENTPEPQEEDEPAATKGK
ATAGATKVPANSHSKATRSATKGAVRTGTEEPSVAGEEPAAGRRVARTRIAVRR
Download sequence
Identical sequences A0A1X6MPL3 B8PC69
104341.JGI94002 XP_002473257.1.31404 jgi|Pospl1|94002|fgenesh3_pg.76__46

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]