SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|94134|fgenesh3_pg.14__110 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|94134|fgenesh3_pg.14__110
Domain Number 1 Region: 238-329
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.01e-24
Family Forkhead DNA-binding domain 0.00081
Further Details:      
 
Domain Number 2 Region: 38-147
Classification Level Classification E-value
Superfamily SMAD/FHA domain 8.91e-16
Family FHA domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|94134|fgenesh3_pg.14__110
Sequence length 687
Sequence
MAALVAHTQDALSSPSRLSPELDSIPAKISAYYSLVFPNFTYYLQTLNVTIGRRCIPASA
ASSSENPQVDVDLGPLKSVSRLHAKIEYEEEEERFVLIVIGRNGAWVDGVWSGSGSKVPL
SDRSQIQIASRTFHFVLPPPPAPEDSPSPSSNSSDNRARSRSPSVDIVDVTSISPPSSLP
SCSPPPAPVSPLANKIPPLSEAALPNSNTISKFKSNAKKRKKSDAAPPPPPPPELMPPKP
PFTYAQLCYRAIKALEGKASLQDICLWIKETYEWYRYCAKDWESSVRHNLSSNPGFKKLL
RSKDEKGKGALWTVDEAFEHNFEEQDARRQAQVAAAATGTGGKDGKVAGKKGKTVVPLEP
PFKRSVKGDVKGPLPPPLTSTPLTLKTNSTTTPSLGLSSLSAAASLHSSISPPLKLDTPV
SVKFEAPAVKLEPLGASFVPSSVHSTSPASGQSAQSPPPGVGSTSHAPEASSSSTIPPTS
AFPAIPATVRIPIVVGPVPTQPSDAPSSPPKPIVLHDNTLILNPEIFSHLTPDHLKDLEA
LGAQKALEILQSYIVRYYKEKLKSEGGRGRGRGRPRRGRGGVGGRGATPSSAPRTDTPTS
GPFTTTPLPPRSAQPSPQTASNSPESTAQLGSRAGVPAPAPPMGSLRPPVDSAPSPILVI
DDDSPDSDEGPSSKRRRLEGAGTGDVS
Download sequence
Identical sequences A0A1X6MVB7 B8P348
XP_002470087.1.31404 jgi|Pospl1|94134|fgenesh3_pg.14__110 104341.JGI94134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]