SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|94206|fgenesh3_pg.2924__1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|94206|fgenesh3_pg.2924__1
Domain Number 1 Region: 13-106
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000123
Family TFIIH domain 0.0083
Further Details:      
 
Domain Number 2 Region: 160-202
Classification Level Classification E-value
Superfamily BSD domain-like 0.0000000000254
Family BSD domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|94206|fgenesh3_pg.2924__1
Sequence length 262
Sequence
MAIQDCKTIAVSLSYKKALGLLELTSTHLQWTQDGKKAPTVRVPHAEAASLFCSKEGASQ
VRLKLGLVGDDAGHNFTFTSPQPVALVEREKFKAELTNIISRNRSGVSTPTLHAPGTPTV
PTSINAASSKIPVTAARTPHSRAASVAGDGRASATPVSDPTSEFRLRKKVLLGNPELAAL
HRELVMGGHITENEFWEGREHLILAQAAAEIQRRGKPGQLVDPRPQTVDGEVKIVITPQL
VHDIFEEFPVVAKAYSDNVPRK
Download sequence
Identical sequences B8PQ09
jgi|Pospl1|94206|fgenesh3_pg.2924__1 XP_002477764.1.31404 104341.JGI94206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]