SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|94374|fgenesh3_pg.119__33 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|94374|fgenesh3_pg.119__33
Domain Number 1 Region: 63-148
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000309
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|94374|fgenesh3_pg.119__33
Sequence length 343
Sequence
MAMQEAQEILAGGTHIAEMLEIIGRLRPAVDNDPLRAETLLEGLEEVSHDLVKRYEKLRG
GLDDDNEGCAICRDEFVDDVAADPLEPAKLSDAVLTSVLFEALPFHPPPCTILAFPCLGR
HLFHSNCLAPWLARKTTCPSCRFDIDPDSLTLRTVTASSQLIDEQFDTRKLWEPPRVSSF
ATWIEQAELAREREAKGIPIVKAVPVDREVDDCPADDEREDMFHPPLAVPNQHNADASRH
SGDVSSGRQPPSTPSAPTTDAAAFPGFLPSIRQGRMEHIMAMLGVETPSSRTAMDLHDSM
LEDVMRALRMGRASVAGMRPPQARPQEDPRTDDLLSQAPVDID
Download sequence
Identical sequences B8PFZ7
104341.JGI94374 XP_002474595.1.31404 jgi|Pospl1|94374|fgenesh3_pg.119__33

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]