SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|94846|fgenesh3_pg.84__5 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|94846|fgenesh3_pg.84__5
Domain Number 1 Region: 483-536
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000442
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|94846|fgenesh3_pg.84__5
Domain Number - Region: 221-266
Classification Level Classification E-value
Superfamily DHH phosphoesterases 0.0331
Family Manganese-dependent inorganic pyrophosphatase (family II) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|94846|fgenesh3_pg.84__5
Sequence length 764
Sequence
MTITVVRKIAEHEAKIVSRRQHIDSSTPFRPSGSHLTAKTLAPVFLDLLQASSLEYPRGL
LSTMMMSSKDVAPADVARRITSASLYEYVVSHPGRSQYSRSGGGVSACGLATLNCARVIF
ELERTGIKNAEFICALDVLRPCLSWSSPVHLDVDEIHKVPIFRKTLKMITSDFAQSGLEQ
FKTVLGRLQDMTRKGGSITCAIVTRPPEIIACFMIPTDGNDYFVIFDSHPRPDKHPHGAG
FILNNSLSATASYITNLLKYDDRLLSDSTLQWQAQLLAHFSAHIFTSSPTSGSAAELTEA
TLQASLEVLSLRARVLDMESQNGYLTTDNERLSGEVSRLEDEVAELKAQARRARAPSQTQ
LFVQDRSYRNASRAVDVIRDSQSQKGKGREVYVPYASTNEVDSKQYIPPRRQIEGNYASS
SRHAGSAYHDPMYDRDFALAAALQAEQMPSQDGAYAASMQREFDGEDARLKAQMTTLKHT
APGIFECGVCLEEFNVDVVARIDICGHQFCRTCILGHTAAKIDERRYPIVCPICMADKGL
KKQGERQYEVFVEMQLAAFSVILHCRKYDISLPLTFDYNAFCFAWLQAATRISATSVERP
LPNQSRGWGSKLHSLHTICGVHYSRMLHEKVVHDGCDRPFVMGRIYAKVISDALRLSRVT
FETWTTSFVASNETADSDYREADATPFASWGPGSILFGICNVLMFSMSTYPVKSDSTVVN
LRMSSQGPTSLVCRISHTRFDNRGFKLVGDTTSSECNTGLAGQM
Download sequence
Identical sequences A0A1X6MUT6 B8PCV5
104341.JGI94846 XP_002473523.1.31404 jgi|Pospl1|94846|fgenesh3_pg.84__5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]