SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|95092|fgenesh3_pg.176__30 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|95092|fgenesh3_pg.176__30
Domain Number 1 Region: 81-141
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000742
Family RING finger domain, C3HC4 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|95092|fgenesh3_pg.176__30
Sequence length 194
Sequence
MRVFNRCPNTILQVLQVPYESSYWYQKALITSELEDIFANAPRSPTDIASARVLDAYARA
TGKAPSGTAEQQGSKKRVPGPEDDCPICYENMHGAAETTLTFCDTCGNGLHTECFQQWAV
TARQKGQQVSCVFCRAKWVTSGPAAAAGASRSSEGYINLGSVAGLSHVRDTSSYYHGPRK
GKRHLGYQDYDNYY
Download sequence
Identical sequences A0A1X6NAV1 B8PJL9
104341.JGI95092 XP_002475875.1.31404 jgi|Pospl1|95092|fgenesh3_pg.176__30

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]