SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|95142|fgenesh3_pg.16__3 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|95142|fgenesh3_pg.16__3
Domain Number 1 Region: 1046-1122
Classification Level Classification E-value
Superfamily RING/U-box 0.00000212
Family ZZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|95142|fgenesh3_pg.16__3
Sequence length 1292
Sequence
MSNSTHTESVPPLPLQRANSSATFESDSSPPTRDVKDLHGPDASGPQDTPPNPHIVAKPT
VSSSEDNDDREISVALGAAFVELQQRVPDHKLPKRLSKLGECHCHKFRDQDMGSAVASQE
SLITTLTAPTKAIMDESGATTAIKNAVSGFAETLPVLMKALDDIGKIHPVIQGSILAHEA
SVAVLAFKAVYTLETKRRNNDAKVIALFVEMRDMIGVLLQYGVLASSVKLKNIKDEAITG
PKGVTIEARLQGLMKQTASDIRSCGNVCDAYSKMSLLAKVLKGPLWEGTFASFVSKFSQR
RDDIEFALSIHIAGKVDGLHDKVDDLAQIVERKTDMIMEFLKNYTPPEHMDVCKQIDRRG
GREAVLKNDDALQELVSTRLETNSSRSSNQATALARNAKHELESQLIDPAFQIQKNTQFF
NRKFEMQQRQILEGVGEIVHRESDRVIETVTSGPHDRILDKDLHQIWKDMGWRGSVKARH
FVLALRDYEQERREEKMRKEATFQVAPTFDPDAWAFDWITVKRLQAITEALDDDASGFIT
VTEANNFTSSRPADWSLPQWLAYWAIGWQISATIYRDKIHEIFEKMFAMRQHLHEANVLM
VDSYLSAVWTDICGITTSLEPFYATPQLLERFQSYIDAEEERLKKNLEAIKYHIDDSTTL
ALVTGPGRIEKYLFPLIYLLLKHDYAVFCIGRKEIVNDRHSIDAFDSQWTINQAVRNRID
DLKGDGRKLARCDKSLMSSLASLKHQRLDLAHHFEHAYSDLYHLIYLSMEDSDSPVPLKA
IQAFPYKAVTYDDTEEDKDVPTAETVLFYAYDQSQLNAGANAMEDTATDEDRKATGNLKN
ILGRWTGYNYTNTEYPFSVMFTVFIHTLNAESTQYEALVHVPDSKVEFKLAGDIVPEADG
KVTYQFRLIIPIHGMLVEYDGTLNEDGSMLSGKWGSNAVRDASFFLSRMPAEVLICRPSP
MELQTDRIRALWRFALTAVQEQVARRRFTWKFLATRRDVRHRYMDLALRTQLGRPLNEAE
DEEGRKCMRALTPLDALICHHVMELRKRTICIHKGIFCDSCDAHDQEITGGRIVCLTCDR
DGGESIDLCEDCIVTEVDRTKRPDLAAPHLPTHDLYKLRSLVHQREFRSIVLMARNALER
ARTAFKDAQDVAHDRTEEDGTGEAEDRLTKIVEEDLTCIKCKERVTQPCWYCIVCEDAVF
VCMKCDAGGGVSEGKHAKTHGLVRCQEEIVEEAEVPAEEKLESMVTSKFAKVDGQFEEVD
TRLRQVDERLSRMEQLLQAIVLKMGAGQDGST
Download sequence
Identical sequences jgi|Pospl1|95142|fgenesh3_pg.16__3 104341.JGI95142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]