SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|95162|fgenesh3_pg.16__23 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|95162|fgenesh3_pg.16__23
Domain Number 1 Region: 764-806
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000334
Family RING finger domain, C3HC4 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|95162|fgenesh3_pg.16__23
Sequence length 811
Sequence
MSETKKRPHAADDDEQLRPKKRAASDDHRSSSRPNGVAAHGDEPTDSDNLETFRKDAIFR
RMKHYAREYERSEARVAELERRRTTCEAGLAALEASWTQFLGTIRLLMKPDDLKPPDVDT
EDLIDLVSHVSADPDQRYVDALRKKMQETSELVAGFVRLASEVHIAAVDKEAYKGCQKAQ
TEERDEFHEDLVVAEKRLDRLQSKIVAVVERKETQAETEAEPSVESPPSPAPQPQQPALN
GHADDTGEWRAIAEVREKHIGALTKEVSDLKRQVLDLRADLQYPSEEVIASTAYCKTLLV
EAEVLRKRHQADEGELQVLQKECDSLQKSRQELQDSAAAASHQGLQELRSMLSKRNDENA
RLREQRDQQQAELSERKHRDQVKLNSLHEYKHLAESRAERIKSLLSENTRLKTRLAANSG
DEDVFSFFLQLDSQILSVDDEHIPSYFAELKQRAAVAESRVAALEASLAQLDQKHPDVGR
HLKLEAEVREQLAQTQQQLQRYQRVYGVTSSGLPPDAQDLAERLRTKEDELRRLQLSEQQ
REKAESALYNELAQLSAAWEGLDRQVKSKLFDLSGMEERLTKSNLEVCTSSHAVEFAVLI
KLQKVKSDNKFYSAMRDKESVETERKNLSRTMEKQAKVIERSVEIEKALKKQLHAMTSER
DNWQKRALLEYRESHAGTRTIDDLQKQVSTMQQRLEALKDNAWAKDKTVEDRAAALRKME
EDVARSKAETERLQAKLKAQVSYQSASSGTREAQLQSEIDKCMNMRNTVITKCMHSFCKS
CVESRIATRQRKCPACNLAFSQGEVQQLYFQ
Download sequence
Identical sequences B8P3G6
104341.JGI95162 XP_002470219.1.31404 jgi|Pospl1|95162|fgenesh3_pg.16__23

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]